The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHB049 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2p77 Target Id ttk003000215.12
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14278, Molecular Weight 19619.44 Da.
    Residues 177 Isoelectric Point 6.44
    Sequence melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtaemagfsprly pelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrfleglkapavlfthggvvr avlralgedglvppgsavavdwprrvlvrlaldgeeatg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.228
    Matthews' coefficent 2.75 Rfactor 0.194
    Waters 402 Solvent Content 55.28

    Ligand Information
    Ligands GOL (GLYCEROL) x 3
    Metals NA (SODIUM) x 1


    Google Scholar output for 2p77

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch