.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p6h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein APE1520 from Aeropyrum pernix K1. To be Published
    Site RSGI
    PDB Id 2p6h Target Id ape001001520.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12107, Molecular Weight 14798.29 Da.
    Residues 134 Isoelectric Point 5.56
    Sequence metgsftvkterrlqvldvtgkveewlstvggvngllvvyvphttaavavneaeprlmedivefirelt kpggpwkhnlvdvnahahlgntiigdsrvipvvggrlslgtwqrilfvemdgprertvnllylge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.203
    Matthews' coefficent 2.57 Rfactor 0.192
    Waters 189 Solvent Content 52.08

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     
    Google Scholar output for 2p6h

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch