The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of aq_1716 from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2p68 Target Id aae001001716.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12078, Molecular Weight 26865.66 Da.
    Residues 248 Isoelectric Point 7.77
    Sequence meiklqgkvslvtgstrgigraiaeklasagstviitgtsgerakavaeeiankygvkahgvemnllse esinkafeeiynlvdgidilvnnagitrdklflrmslldweevlkvnltgtflvtqnslrkmikqrwgr ivnissvvgftgnvgqvnysttkagligftkslakelaprnvlvnavapgfietdmtavlseeikqkyk eqiplgrfgspeevanvvlflcselasyitgevihvnggmf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.84 Rfree 0.223
    Matthews' coefficent 2.32 Rfactor 0.183
    Waters 511 Solvent Content 46.90

    Ligand Information


    Google Scholar output for 2p68

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch