.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p3e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title To be Published. To be Published
    Site RSGI
    PDB Id 2p3e Target Id aae001001208.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12060, Molecular Weight 46963.49 Da.
    Residues 420 Isoelectric Point 5.43
    Sequence mellkeynpyleyrdgelfiegvslkelaqtfgtplyvyssnfikerfeayrkafpdalicyavkanfn phlvkllgelgagadivsggelylakkagipperivyagvgktekeltdavdseilmfnvesrqeldvl neiagklgkkariairvnpdvdpkthpyiatgmqkskfgvdireaqkeyeyasklenleivgihchigs qildispyreavekvvslyesltqkgfdikyldiggglgikykpedkepapqdladllkdllenvkaki ilepgrsimgnagilitqvqflkdkgskhfiivdagmndlirpsiynayhhiipvetkerkkvvadivg picetgdflaldreieevqrgeylavlsagaygfamsshynmrpraaevlvengsvklirkrenydyiv epsldi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.99 Rfree 0.21793
    Matthews' coefficent 2.67 Rfactor 0.18478
    Waters 561 Solvent Content 54.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p3e

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch