The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHB049 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2p30 Target Id ttk003000215.7
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14295, Molecular Weight 19619.44 Da.
    Residues 177 Isoelectric Point 6.44
    Sequence melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtaelagfsprly pelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrfleglkapavlfthggvvr avlralgedglvppgsavavdwprrvlvrlamdgeeatg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.238
    Matthews' coefficent 1.81 Rfactor 0.209
    Waters 160 Solvent Content 32.22

    Ligand Information


    Google Scholar output for 2p30

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch