.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p2y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHB049 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2p2y Target Id ttk003000215.8
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14296, Molecular Weight 19619.44 Da.
    Residues 177 Isoelectric Point 6.44
    Sequence melwmvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtaelagfsprly pelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrfleglkapavlfthggvvr avlralgedglvppgsavavdwprrvlvrlaldgeeatg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.254
    Matthews' coefficent 1.81 Rfactor 0.225
    Waters 158 Solvent Content 32.01

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2p2y

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch