.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p2w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of citrate synthase from Thermotoga maritima MSB8. To be Published
    Site RSGI
    PDB Id 2p2w Target Id tma001000290.1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS14072, Molecular Weight 42302.62 Da.
    Residues 367 Isoelectric Point 6.14
    Sequence miqkglegvkicessicyldgingrlyyrgipveelaekstfeetayflwygklptkseleefkrkmad yrelpaealgilyhlpknlhyidvlkiflsihgsmdgndedlrekairvasvfptilayyyryskgkel irprkdlshvenfyymmfgernekirllesafillmeqdinastfaalviastlsdlyscivgalgalk gplhggasekvppmleeigsedrveefvqkclkekrkimgfghrvyktydpravflkrvlqehfpdskl friaskleeyivsnkikniypnvdlyssvlfeelgfprnmftalfatarvvgwtahvieyvsdnklirp tseyvgpmdveyipierrdeng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.187
    Matthews' coefficent 2.75 Rfactor 0.175
    Waters 353 Solvent Content 55.27

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands FLC (CITRATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2p2w

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch