.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p2o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Maltose Transacetylase from Geobacillus Kaustophilus at 1.8 Angstrom Resolution. To be Published
    Site RSGI
    PDB Id 2p2o Target Id gka001001921.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12305, Molecular Weight 20781.73 Da.
    Residues 187 Isoelectric Point 6.48
    Sequence ghmksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstgerlfiepnf rcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldphernsgleygkpvvighn vwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakvikwlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.74 Rfree 0.2375
    Matthews' coefficent 2.36 Rfactor 0.18353
    Waters 1167 Solvent Content 47.95

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p2o

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch