.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ozp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TTHA1904) from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2ozp Target Id ttk003000050.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14206, Molecular Weight 38088.69 Da.
    Residues 345 Isoelectric Point 8.71
    Sequence mtgkktlsivgasgyaggeflrlalshpylevkqvtsrrfagepvhfvhpnlrgrtnlkfvppeklepa dilvlalphgvfarefdrysalapvlvdlsadfrlkdpelyrryygehprpdllgrfvyavpelyreal kgadwiagagcnatatllglypllkagvlkptpifvtllistsaggaeaspashhperagsirvykptg hrhtaevvenlpgrpevhltaiatdrvrgilmtaqcfvqdgwserdvwqayreayagepfirlvkqkkg vhrypdprfvqgtnyadigfeleedtgrlvvmtaidnlvkgtaghalqalnvrmgwpetlgldfpglhp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.01 Rfree 0.207
    Matthews' coefficent 3.37 Rfactor 0.185
    Waters 301 Solvent Content 63.50

    Ligand Information
    Ligands SO4 (SULFATE) x 2;AZI (AZIDE) x 7
    Metals

    Jmol

     
    Google Scholar output for 2ozp

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch