.
The Open Protein Structure Annotation Network
PDB Keyword
.

2om6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical Protein (Probable Phosphoserine Phosph (PH0253) from Pyrococcus Horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2om6 Target Id pho001000253.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13807, Molecular Weight 26844.73 Da.
    Residues 235 Isoelectric Point 5.81
    Sequence mrevklvtfdvwntlldlnimldefshqlakisglhikdvanavievrneikkmraqasedprkvltgs qealagklkvdvelvkratarailnvdeslvlegtkealqfvkerglktavignvmfwpgsytrlller fglmefidktffadevlsykprkemfekvlnsfevkpeeslhigdtyaedyqgarkvgmwavwinqegd kvrkleergfeipsianlkdvieliskt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.259
    Matthews' coefficent 2.29 Rfactor 0.186
    Waters 443 Solvent Content 46.37

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals CL (CHLORIDE) x 2;MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2om6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch