.
The Open Protein Structure Annotation Network
PDB Keyword
.

2it2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of PH1069 protein from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 2it2 Target Id pho001001069.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13969, Molecular Weight 23176.92 Da.
    Residues 200 Isoelectric Point 9.33
    Sequence mllymrftenferakkealmsleialrkgevdediipllkkinsienyfttsscsgrisvmemphfgdk vnakwlgkwhrevslyevleaikkhrsgqlwflvrspilhvgaktledavklvnlavscgfkysniksi snkkliveirstermdvllgengeifvgeeylnkiveiandqmrrfkeklkrleskinalnr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.265
    Matthews' coefficent 1.96 Rfactor 0.25
    Waters 314 Solvent Content 37.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2it2

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch