The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of PH0203 protein from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 2it1 Target Id pho001000203.3
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13795, Molecular Weight 40809.43 Da.
    Residues 362 Isoelectric Point 6.31
    Sequence mveiklenivkkfgnftalnninlkikdgefmallgpsgsgkstllytiagiykptsgkiyfdekdvte lppkdrnvglvfqnwalyphmtvykniafplelrkapreeidkkvrevakmlhidkllnrypwqlsggq qqrvaiaralvkepevllldeplsnldallrlevraelkrlqkelgittvyvthdqaealamadriavi regeilqvgtpdevyykpkykfvggflgnppmnfveakvedgklviteksklpipkqyveivketgite viigfrphdaeivkgegegivgevysfeplgreqivtvsvndsivkvfapegehfsfgekvtikvkeel lvlfdkktekalefskl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.94 Rfree 0.25
    Matthews' coefficent 2.10 Rfactor 0.21
    Waters 375 Solvent Content 41.56

    Ligand Information
    Ligands SO4 (SULFATE) x 1


    Google Scholar output for 2it1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch