.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ip4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Glycinamide Ribonucleotide Synthetase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2ip4 Target Id ttk003000101.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14225, Molecular Weight 44459.81 Da.
    Residues 417 Isoelectric Point 5.45
    Sequence mkvlvvgsggrehallwkaaqsprvkrlyaapgnagmealaelvpwngdvealadwalaegidltlvgp eaplvegiadafqarglllfgptqkaamiegskafakglmerygiptaryrvfreplealayleevgvp vvvkdsglaagkgvtvafdlhqakqavanilnraeggevvveeylegeeatvlaltdgetilpllpsqd hkrlldgdqgpmtggmgavapypmdeatlrrveeeilgplvrglraegvvyrgvvyaglmltregpkvl efnarfgdpeaqallpllendlvelalrvaegrlagtrlswkegaaacvvlaapgypesprkgiplhvp eppegvlvfhagtrreggrlvsaggrvlnvvglgrdlkealerayayipqvgfpgavyrrdigrralarlst
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.238
    Matthews' coefficent 2.39 Rfactor 0.2185
    Waters 24 Solvent Content 48.55

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 2ip4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch