.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iih

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the molybdenum cofactor biosynthesis protein C (TTHA1789) from thermus theromophilus HB8 (H32 form). To be Published
    Site RSGI
    PDB Id 2iih Target Id ttk003000255.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14308, Molecular Weight 16920.82 Da.
    Residues 157 Isoelectric Point 6.84
    Sequence mdlthfqdgrprmvdvtekpetfrtataeafvelteealsalekggvgkgdplvvaqlagilaakktad liplchplpltgvevrvellkaekrvrieatvktkaetgvemeamtacavaaltvydmlkaaskglvis qvrllhkaggksgewrreq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.217
    Matthews' coefficent 1.91 Rfactor 0.196
    Waters 171 Solvent Content 35.60

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2iih

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch