The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the molybdenum cofactor biosynthesis protein C (TTHA1789) from Thermus Theromophilus HB8. To be Published
    Site RSGI
    PDB Id 2ide Target Id ttk003000255.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14307, Molecular Weight 16920.82 Da.
    Residues 157 Isoelectric Point 6.84
    Sequence mdlthfqdgrprmvdvtekpetfrtataeafvelteealsalekggvgkgdplvvaqlagilaakktad liplchplpltgvevrvellkaekrvrieatvktkaetgvemeamtacavaaltvydmlkaaskglvis qvrllhkaggksgewrreq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 1.90 Rfree 0.226
    Matthews' coefficent 1.95 Rfactor 0.195
    Waters 1584 Solvent Content 36.86

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 12


    Google Scholar output for 2ide

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch