The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein PH0414 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2hun Target Id pho001000414.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13818, Molecular Weight 38925.64 Da.
    Residues 336 Isoelectric Point 6.34
    Sequence mhsmkllvtggmgfigsnfiryilekhpdwevinidklgygsnpanlkdleddprytfvkgdvadyelv kelvrkvdgvvhlaaeshvdrsisspeiflhsnvigtytllesirrenpevrfvhvstdevygdilkgs ftendrlmpsspysatkaasdmlvlgwtrtynlnasitrctnnygpyqfpeklipktiiraslglkipi ygtgknvrdwlyvedhvraielvllkgesreiynisageektnlevvkiilrlmgkgeelielvedrpg hdlrysldswkitrdlkwrpkytfdegikktidwylknewwwkplvderilhptpwklkw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.07 Rfree 0.232
    Matthews' coefficent 2.63 Rfactor 0.204
    Waters 484 Solvent Content 53.20

    Ligand Information


    Google Scholar output for 2hun

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch