.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hoq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Probable Haloacid Dehalogenase Protein (Ph1655) from Pyrococcus Horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2hoq Target Id pho001001655.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14002, Molecular Weight 28257.17 Da.
    Residues 241 Isoelectric Point 7.82
    Sequence mvkviffdlddtlvdtsklaeiarknaienmirhglpvdfetayselielikeygsnfpyhfdyllrrl dlpynpkwisagviayhntkfaylrevpgarkvlirlkelgyelgiitdgnpvkqwekilrlelddffe hviisdfegvkkphpkifkkalkafnvkpeealmvgdrlysdiygakrvgmktvwfrygkhsereleyr kyadyeidnlesllevlaresssnkkvhpprqqi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.248
    Matthews' coefficent 2.23 Rfactor 0.215
    Waters 213 Solvent Content 44.88

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hoq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch