.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hhh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation. Nat.Struct.Mol.Biol. 13 871-878 2006
    Site RSGI
    PDB Id 2hhh Target Id ttk003000838.5
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14455, Molecular Weight 29275.12 Da.
    Residues 256 Isoelectric Point 5.46
    Sequence mpveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrggtil fvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspeieerpkkeqvrl khelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvialadtdsdpdlvdyiipgndda irsiqlilsravdliiqarggvvepspsyalvqeaeatetpegesevea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.35 Rfree 0.289
    Matthews' coefficent 4.64 Rfactor 0.265
    Waters Solvent Content 73.48

    Ligand Information
    Ligands KSG ((1S,2R,3S,4R,5S,6S)-2,3,4,5,6-PENTAHYDROXYCYCLOHEXYL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2hhh

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch