.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hd9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Nucleant-mediated protein crystallization with the application of microporous synthetic zeolites. Acta Crystallogr.,Sect.D 64 686-695 2008
    Site RSGI
    PDB Id 2hd9 Target Id pho001001033.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13966, Molecular Weight 17428.74 Da.
    Residues 145 Isoelectric Point 9.79
    Sequence mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepkivgiyevtse pyvdfsrifkphrggketypyrvkikpikigeinfkplindlkfiknkkrwsmhffgkamrelpeedyk lieklll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.234
    Matthews' coefficent 2.21 Rfactor 0.228
    Waters 211 Solvent Content 44.46

    Ligand Information
    Ligands CIT (CITRIC) x 2;GOL (GLYCEROL) x 1
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 2hd9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch