The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the archaea specific DNA binding protein from Aeropyrum pernix K1. To be Published
    Site RSGI
    PDB Id 2h9u Target Id ape001001823.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12109, Molecular Weight 11379.60 Da.
    Residues 102 Isoelectric Point 9.10
    Sequence macegapevrigrkpvmnyvlailttlmeqgtnqvvvkargrninravdaveivrkrfaknieikdiki dsqeievqtpegqtrtrrvssieiclekagesa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.247
    Matthews' coefficent 1.98 Rfactor 0.231
    Waters 98 Solvent Content 38.02

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 6


    Google Scholar output for 2h9u

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch