The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second SH2 domain of human Ras GTPase-activating protein 1. To be Published
    Site RSGI
    PDB Id 2gsb Target Id hso002001246.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12968, Molecular Weight 12526.54 Da.
    Residues 106 Isoelectric Point 5.89
    Sequence reedphegkiwfhgkiskqeaynllmtvgqvcsflvrpsdntpgdyslyfrtneniqrfkicptpnnqf mmggryynsigdiidhyrkeqivegyylkepvpmqdq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2gsb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch