.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gqj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the two zf-C2H2 like domains(493-575) of human zinc finger protein KIAA1196. To be Published
    Site RSGI
    PDB Id 2gqj Target Id hsk002001170.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12634, Molecular Weight 9429.26 Da.
    Residues 85 Isoelectric Point 8.48
    Sequence pggpeeqwqraihergeavcptcnvvtrktlvglkkhmevcqklqdalkcqhcrkqfkskaglnyhtma ehsakpsdaeasegge
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2gqj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch