.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gqh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 15th Ig-like domain of human KIAA1556 protein. To be Published
    Site RSGI
    PDB Id 2gqh Target Id hsk002001528.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12667, Molecular Weight 10260.98 Da.
    Residues 94 Isoelectric Point 4.98
    Sequence arfteglrneeamegatatlqcelskaapvewrkglealrdgdkyslrqdgavcelqihglamadngvy scvcgqertsatltvralparfied
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gqh

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch