The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 2'-5' RNA ligase-like protein from Pyrococcus furiosus. To be Published
    Site RSGI
    PDB Id 2fyh Target Id ar_001000706.1
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS12210, Molecular Weight 20994.38 Da.
    Residues 184 Isoelectric Point 8.57
    Sequence mrafiaidvsesvrdalvraqdyigskeakikfverenfhitlkflgeiteeqaeeikkilekiakkyk khevnvrgigvfpnpnyvrviwagvendeiikkiakeiddelaklgfkkegnfvahitlgrvkfvkdkl glamklkelanedfgsfiveaielkkstltpkgpiyetlarfelse
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2fyh

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch