.
The Open Protein Structure Annotation Network
PDB Keyword
.

2evb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate. J.Biol.Chem. 283 14739-14750 2008
    Site RSGI
    PDB Id 2evb Target Id pho001001284.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13983, Molecular Weight 15983.89 Da.
    Residues 149 Isoelectric Point 5.64
    Sequence mmrmkvkvvvngkeyeveveevmpgkfrvtlegetyevetsagfvtspkqvqvptpaptpapaptptpa papssktvvsenvvsapmpgkvlrvlvrvgdrvrvgqgllvleamkmeneipsprdgvvkrilvkegea vdtgqplielg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.283
    Matthews' coefficent 1.93 Rfactor 0.248
    Waters 111 Solvent Content 36.32

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2evb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch