The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Shikimate Dehydrogenase AroE from Thermus thermophilus HB8 and its Cofactor and Substrate Complexes: Insights into the Enzymatic Mechanism. J.Mol.Biol. 373 424-438 2007
    Site RSGI
    PDB Id 2ev9 Target Id ttk003000004.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14151, Molecular Weight 28282.22 Da.
    Residues 263 Isoelectric Point 8.07
    Sequence mlrfavlghpvahslspamhafaleslglegsyeawdtplealpgrlkevrrafrgvnltlplkeaala hldwvspeaqrigavntvlqvegrlfgfntdapgflealkaggiplkgpalvlgaggagravafalrea glevwvwnrtpqralalaeefglravplekarearllvnatrvgledpsasplpaelfpeegaavdlvy rplwtrflreakakglkvqtglpmlawqgalafrlwtgllpdpsgmeeaarralgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.236
    Matthews' coefficent 2.21 Rfactor 0.21
    Waters 418 Solvent Content 44.37

    Ligand Information
    Ligands SO4 (SULFATE) x 2;SKM ((3R,4S,5R)-3,4,5-TRIHYDROXYCYCLOHEX-1-ENE-1-) x 2;NAP (NADP) x 1


    Google Scholar output for 2ev9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch