.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eqp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the stn_TNFRSF12A_TNFR domain of Tumor necrosis factor receptor superfamily member 12A precursor. To be Published
    Site RSGI
    PDB Id 2eqp Target Id hsg002001058.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12340, Molecular Weight 4433.64 Da.
    Residues 43 Isoelectric Point 5.47
    Sequence eqapgtapcsrgsswsadldkcmdcascrarphsdfclgcaaa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2eqp

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch