The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the TUDOR domain of PHD finger protein 20-like 1 [Homo sapiens]. To be Published
    Site RSGI
    PDB Id 2eqm Target Id hso003013074.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13165, Molecular Weight 9978.88 Da.
    Residues 81 Isoelectric Point 7.99
    Sequence mskkppnrpgitfeigarlealdylqkwypsriekidyeegkmlvhferwshrydewiywdsnrlrple rpalrkeglkde
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2eqm

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch