The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of lipoamide dehydrogenase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2eq9 Target Id ttk003000509.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14400, Molecular Weight 49081.29 Da.
    Residues 464 Isoelectric Point 6.42
    Sequence mtpmktydlivigtgpggyhaairaaqlglkvlaveagevggvclnvgciptkallhaaetlhhlkvae gfglkakpeldlkklggwrdqvvkkltggvgtllkgngvellrgfarlvgpkevevggerygakslila tgseplelkgfpfgedvwdstralkveeglpkrllvigggavglelgqvyrrlgaevtlieympeilpq gdpetaallrralekegirvrtktkavgyekkkdglhvrlepaeggegeevvvdkvlvavgrkprtegl glekagvkvdergfirvnarmetsvpgvyaigdaarppllahkamregliaaenaagkdsafdyqvpsv vytspewagvglteeeakragykvkvgkfplaasgraltlggaegmvkvvgdeetdlllgvfivgpqag eliaeaalalemgatltdlaltvhphptlseslmeaaeafhkqaihilnr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.09 Rfree 0.257
    Matthews' coefficent 2.61 Rfactor 0.217
    Waters 1007 Solvent Content 52.86

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 8


    Google Scholar output for 2eq9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch