The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the secound C2H2 type zinc finger domain of Zinc finger protein 32. To be Published
    Site RSGI
    PDB Id 2epu Target Id hsi002014866.5
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12522, Molecular Weight 3596.94 Da.
    Residues 32 Isoelectric Point 9.70
    Sequence tgqkpfecthcgksfrakgnlvthqrihtgek
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 2epu

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch