.
The Open Protein Structure Annotation Network
PDB Keyword
.

2epj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from Aeropyrum pernix. To be Published
    Site RSGI
    PDB Id 2epj Target Id ape001002299.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12117, Molecular Weight 48684.23 Da.
    Residues 453 Isoelectric Point 6.23
    Sequence mgsshhhhhhssgenlyfqghmdvlasgeksrmlfertkelfpggvnspvraavkpypfyvkrgegayl ytvdgarivdlvlaygplilghkhprvleaveealargwlygapgeaevllaekilgyvkrggmirfvn sgteatmtairlargytgrdlilkfdgcyhgshdavlvaagsaaahygvptsagvpeavarltlvtpyn dvealervfaeygdriagvivepvianagvipprreflaalqrlsresgallildevvtgfrlglegaq gyfniegdiivlgkiigggfpvgavagsrevmslltpqgkvfnagtfnahpitmaaglatlkaleeepv ysvsreaakaleeaasevldrtglpytinrvesmmqlfigveevsnaaqarkadkkfyvklheemlrrg vfiapsnleavftglphqgealeiaveglrsslktvlgs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.194
    Matthews' coefficent 2.47 Rfactor 0.165
    Waters 407 Solvent Content 50.30

    Ligand Information
    Ligands PMP (4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2epj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch