The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure pf hypothetical protein MJ1052 from Methanocaldococcus jannascii. To be Published
    Site RSGI
    PDB Id 2epi Target Id mja001001052.2
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13377, Molecular Weight 11222.59 Da.
    Residues 100 Isoelectric Point 8.80
    Sequence mifmrkvvaevsiiplgkgasvskyvkkaievfkkydlkvetnamgtvlegdldeilkafkeahstvln dvdrvvsslkiderkdkentierklkaigel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.247
    Matthews' coefficent 2.13 Rfactor 0.207
    Waters 419 Solvent Content 42.28

    Ligand Information


    Google Scholar output for 2epi

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch