The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Rabbit L-Gulonate 3-Dehydrogenase (NADH Form). To be Published
    Site RSGI
    PDB Id 2ep9 Target Id my_001000051.2
    Molecular Characteristics
    Source Oryctolagus cuniculus
    Alias Ids TPS13734, Molecular Weight 35270.89 Da.
    Residues 320 Isoelectric Point 6.67
    Sequence maspaagdvlivgsglvgrswamlfasggfrvklydieprqitgalenirkemkslqqsgslkgslsae eqlslissctnlaeavegvvhiqecvpenldlkrkifaqldsivddrvvlssssscllpsklftglahv kqcivahpvnppyyiplvelvphpetspatvdrthalmrkigqspvrvlkeidgfvlnrlqyaiiseaw rlveegivspsdldlvmsdglgmryafigpletmhlnaegmlsysdrysegmkrvlksfgsipefsgat vekvnqamckkgpadpehlaarrewrdeclkrelaklkrqmqpq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.214
    Matthews' coefficent 2.25 Rfactor 0.167
    Waters 452 Solvent Content 45.45

    Ligand Information


    Google Scholar output for 2ep9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch