The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second C2 domain from human MCTP2 protein. To be Published
    Site RSGI
    PDB Id 2ep6 Target Id hsi002011251.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12446, Molecular Weight 14237.62 Da.
    Residues 126 Isoelectric Point 4.69
    Sequence dvkdvgilqvkvlkaadllaadfsgksdpfcllelgndrlqthtvyknlnpewnkvftfpikdihdvle vtvfdedgdkppdflgkvaipllsirdgqpncyvlknkdleqafkgviylemdliyn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2ep6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch