The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural study of Project ID ST1242 from Sulfolobus tokodaii strain7. To be Published
    Site RSGI
    PDB Id 2ep5 Target Id sto001001242.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14049, Molecular Weight 38692.24 Da.
    Residues 350 Isoelectric Point 8.35
    Sequence madkikvsllgstgmvgqkmvkmlakhpylelvkvsaspskigkkykdavkwieqgdipeevqdlpivs tnyedhkdvdvvlsalpnelaesielelvkngkivvsnaspfrmdpdvplinpeinwehlellkfqker kgwkgilvknpnctaaimsmpikplieiatkskiiittlqavsgagyngisfmaiegniipyikgeedk iakeltklngklennqiipanldstvtsirvptrvghmgvinivtnerinieeikktlknfkslpqqkn lptapkqpiivrdeedrpqpiidvnaesgmavtvgrirhennvlrlvvlgdnlvrgaagitiltvevmk elgyi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.242
    Matthews' coefficent 2.64 Rfactor 0.191
    Waters 677 Solvent Content 53.33

    Ligand Information


    Google Scholar output for 2ep5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch