The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the C2H2 type zinc finger (region 693-723) of human Zinc finger protein 268. To be Published
    Site RSGI
    PDB Id 2eog Target Id hso003011774.9
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13134, Molecular Weight 3524.95 Da.
    Residues 31 Isoelectric Point 9.51
    Sequence vkpygcsecgkafrsksyliihmrthtgekp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 2eog

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch