.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eof

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the C2H2 type zinc finger (region 411-441) of human Zinc finger protein 268. To be Published
    Site RSGI
    PDB Id 2eof Target Id hso003011774.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13129, Molecular Weight 3581.81 Da.
    Residues 31 Isoelectric Point 6.63
    Sequence tgekpyecnecqkafntksnlmvhqrthtge
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2eof

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch