The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second SH2 domain from rat PLC gamma-2. To be Published
    Site RSGI
    PDB Id 2eob Target Id ar_001000555.1
    Molecular Characteristics
    Source Rattus rattus
    Alias Ids TPS12188, Molecular Weight 13264.49 Da.
    Residues 111 Isoelectric Point 9.58
    Sequence dpvpnpnpheskpwyydrlsrgeaedmlmriprdgaflirkregtdsyaitfrargkvkhcrinrdgrh fvlgtsayfeslvelvsyyekhalyrkmrlrypvtpellery
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2eob

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch