The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural study of Project ID TTHB049 from Thermus thermophilus HB8 (W85H). To be Published
    Site RSGI
    PDB Id 2eoa Target Id ttk003000215.20
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14287, Molecular Weight 19552.33 Da.
    Residues 177 Isoelectric Point 6.53
    Sequence melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtaelagfsprly pelreihfgalegalhetldprykeallrfqgfhppggeslsafqervfrfleglkapavlfthggvvr avlralgedglvppgsavavdwprrvlvrlaldgeeatg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.227
    Matthews' coefficent 2.74 Rfactor 0.200
    Waters 437 Solvent Content 55.08

    Ligand Information


    Google Scholar output for 2eoa

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch