The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a mutant pyrrolidone carboxyl peptidase (A199P) from P. furiosus. To be Published
    Site RSGI
    PDB Id 2eo8 Target Id my_001000146.1
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS13751, Molecular Weight 22814.46 Da.
    Residues 208 Isoelectric Point 6.23
    Sequence mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeikpdiaihvgl apgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikkimkklhergipayisnsag lylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigkgqvppsmsyemeleavkvpievaleell
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.23542
    Matthews' coefficent 2.82 Rfactor 0.1847
    Waters 317 Solvent Content 56.44

    Ligand Information


    Google Scholar output for 2eo8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch