The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SH2 domain from mouse B-cell linker protein BLNK. To be Published
    Site RSGI
    PDB Id 2eo6 Target Id ar_001000487.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS12164, Molecular Weight 14481.54 Da.
    Residues 128 Isoelectric Point 9.34
    Sequence pfnstfadqeaellgkpwyagacdrksaeealhrsnkdgsflirkssghdskqpytlvaffnkrvynip vrfieatkqyalgkkkngeeyfgsvveivnshqhnplvlidsqnntkdstrlkyavkvs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2eo6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch