.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eo4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical histidine triad nucleotide-binding protein ST2152 from Sulfolobus tokodaii strain7. To be Published
    Site RSGI
    PDB Id 2eo4 Target Id sto001002152.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14060, Molecular Weight 17432.25 Da.
    Residues 150 Isoelectric Point 6.22
    Sequence mctfcsiinrelegyfvyedekfaaildkypvslghtlvipkkhfenyleadedtlaelakvvklvslg ikdavkadglrlltnigrsagqvifhlhvhiiptwegdypdifksfkprkeqekeyyellqkiiresie nlkrkigdykwg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.228
    Matthews' coefficent 3.63 Rfactor 0.205
    Waters 140 Solvent Content 66.11

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2eo4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch