The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SH2 domain from human Crk-like protein. To be Published
    Site RSGI
    PDB Id 2eo3 Target Id hso002001392.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12980, Molecular Weight 11993.81 Da.
    Residues 104 Isoelectric Point 6.90
    Sequence mssarfdssdrsawymgpvsrqeaqtrlqgqrhgmflvrdsstcpgdyvlsvsensrvshyiinslpnr rfkigdqefdhlpallefykihyldtttliepapr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2eo3

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch