The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution sturcture of the C4-type zinc finger domain from human Peroxisome proliferator-activated receptor delta. To be Published
    Site RSGI
    PDB Id 2env Target Id hsi002005357.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12389, Molecular Weight 8789.93 Da.
    Residues 75 Isoelectric Point 9.53
    Sequence mecrvcgdkasgfhygvhacegckgffrrtirmkleyekcersckiqkknrnkcqycrfqkclalgmsh nairfg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2env

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch