The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second C2H2-type zinc finger domain from human Krueppel-like factor 15. To be Published
    Site RSGI
    PDB Id 2ent Target Id hsi002021967.4
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12536, Molecular Weight 4016.29 Da.
    Residues 35 Isoelectric Point 10.08
    Sequence tgekpfactwpgcgwrfsrsdelsrhrrshsgvkp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 2ent

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch