The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of a putativ DNA-binding domain of the humansolute carrier family 30 (zinc transporter) protein. To be Published
    Site RSGI
    PDB Id 2enk Target Id hss001002352.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13293, Molecular Weight 11379.28 Da.
    Residues 94 Isoelectric Point 9.37
    Sequence kytqnnfitgvrainefclkssdleqlrkirrrsphedtesftvylrsdveakslevwgspealarekk lrkeaeieyrerlfrnqkilreyrd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2enk

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch