The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical Conserved Protein (GK1048) from Geobacillus Kaustophilus. To be Published
    Site RSGI
    PDB Id 2emq Target Id gka001001048.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12296, Molecular Weight 18259.42 Da.
    Residues 159 Isoelectric Point 7.23
    Sequence ghmtwehnefmqmtvkpflipadkvahvqpgnyldhallvltktgysaipvldtsyklhglismtmmmd ailglerieferletmkveevmnrniprlrlddslmkavglivnhpfvcvenddgyfagiftrrevlkq lnkqlhrpnggrklgrkeaeq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.293
    Matthews' coefficent 2.66 Rfactor 0.231
    Waters 57 Solvent Content 53.75

    Ligand Information


    Google Scholar output for 2emq

    Protein Summary

    Please see 1vr9 entry.

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch