The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SANT domain of fission yeast SPCC24B10.08c protein. To be Published
    Site RSGI
    PDB Id 2elk Target Id my_001000054.2
    Molecular Characteristics
    Source Schizosaccharomyces pombe
    Alias Ids TPS13736, Molecular Weight 5880.10 Da.
    Residues 51 Isoelectric Point 4.16
    Sequence fdenwgadeelllidacetlglgnwadiadyvgnartkeecrdhylktyie
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2elk

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch