.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eli

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second Phorbol esters/diacylglycerol binding domain of human Protein kinase C alpha type. To be Published
    Site RSGI
    PDB Id 2eli Target Id hso002102639.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13029, Molecular Weight 8749.61 Da.
    Residues 78 Isoelectric Point 7.80
    Sequence gpdtddprskhkfkihtygsptfcdhcgsllyglihqgmkcdtcdmnvhkqcvinvpslcgmdhtekrg riylkaeva
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2eli

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch