The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHA1842 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2elc Target Id ttk003000014.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14157, Molecular Weight 34248.85 Da.
    Residues 329 Isoelectric Point 5.69
    Sequence mdavkkailgevleeeeayevmralmagevspvraagllvalslrgerpheiaamaramreaarplrvh rrplldivgtggdgkglmxlstlaalvaaaggvavakhgxraassragsadllealgvdleappervge aieelgfgflfarvfhpamrhvapvraelgvrtvfxllgpltxpagadayvlgvfspewlapmaealer lgarglvvhgegadelvlgexrvvevgkgayaltpeevglkraplealkgggpeexaalarrllkgeek gpladavalaagagfyaagktpslkegvalarevlasgeayllleryvaflra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.55 Rfree 0.202
    Matthews' coefficent 2.53 Rfactor 0.187
    Waters 1569 Solvent Content 51.43

    Ligand Information
    Ligands GOL (GLYCEROL) x 12
    Metals NA (SODIUM) x 2


    Google Scholar output for 2elc

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch